PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN13225.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 333aa    MW: 36729.1 Da    PI: 6.7533
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN13225.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.5e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+ +Wk++++  g+ R+ k+c++rw +yl
       KHN13225.1 14 KGPWTPEEDIILVSYIQEHGPSNWKAVPANTGLSRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding50.45.2e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E++ ++++ ++lG++ W++Ia++++  Rt++++k++w++yl
       KHN13225.1  67 RGNFTDQEEKMIIHLQALLGNR-WAAIAAYLP-QRTDNDIKNYWNTYL 112
                      89********************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.9E-24564IPR009057Homeodomain-like
PROSITE profilePS5129418.133961IPR017930Myb domain
SuperFamilySSF466893.91E-3011108IPR009057Homeodomain-like
SMARTSM007176.9E-151363IPR001005SANT/Myb domain
PfamPF002493.0E-161461IPR001005SANT/Myb domain
CDDcd001672.84E-111661No hitNo description
PROSITE profilePS5129424.76462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.9E-2565117IPR009057Homeodomain-like
SMARTSM007172.0E-1566114IPR001005SANT/Myb domain
PfamPF002493.4E-1567112IPR001005SANT/Myb domain
CDDcd001674.97E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MGRPPCCDKE GVKKGPWTPE EDIILVSYIQ EHGPSNWKAV PANTGLSRCS KSCRLRWTNY  60
LRPGIKRGNF TDQEEKMIIH LQALLGNRWA AIAAYLPQRT DNDIKNYWNT YLKKKLNKLE  120
AGSDQGHNIG VSVSQPMSRG QWERRLQTDI RMAKRALIEA LSSNKASSSS TLLLAESNSN  180
LSSENSIFYN SNTNKPTAQS MCYASSADNI ARLLKGWMKN TPKLASCAAS AVTQNSFNNL  240
AGADTAFSEG ITTTKGSTST STVELSETFD SLFGYESLDY SSNSEFSPSL SPEATPFQDE  300
SKPDITADGI DMPFSLLEKW LLDDAACQEK LGF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-271411627128MYB TRANSFORMING PROTEIN
1mse_C6e-27141164105C-Myb DNA-Binding Domain
1msf_C6e-27141164105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0961950.0BT096195.1 Soybean clone JCVI-FLGm-20D5 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003543783.10.0PREDICTED: myb-related protein 306
SwissprotP813921e-111MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0B2PVP50.0A0A0B2PVP5_GLYSO; Myb-related protein 306
STRINGGLYMA13G05370.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101634115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.17e-98myb domain protein 30
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]